Sitzung fortführen?
Automatische Abmeldung in: 
Sitzung abgelaufen!
Ihre Sitzung ist abgelaufen. Zu Ihrer Sicherheit haben wir Sie abgemeldet.
Möchten Sie sich wieder anmelden?

Anti-H1FX Mouse Monoclonal Antibody

Lieferant: Abnova

Mouse monoclonal antibody raised against a full-length recombinant H1FX.

Type: Primary
Antigen: H1FX
Clonality: Monoclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype:
Reactivity: Human



Melden Sie sich an um Ihre Preise und die Verfügbarkeit zu sehen
  Auf diesem Gerät angemeldet bleiben
 

PRODUKT

Erweitert / Kompakt
Größe VE Katalognummer Menge
Up to 5 Clones 1 ABNOH00008971-M
Barcode erstellen Barcode Label Format: 
PDF Katalogseiten erstellen

TECHNISCHE DATEN

Antigen symbol H1FX
Antigen name H1 histone family, member X
Reaktivität Human
Konjugation Unconjugated
Klonalität Monoclonal
Antikörper Typ Primary
Wirt Mouse
Western Blot Yes
ELISA Yes
Antigen synonyms H1X, H1.10
Amino acid number 1 to 213
Gene ID 8971
Format Liquid
Cross Adsorption No
Immunogen H1FX (NP_006017.1, 1 a.a. ~ 213 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence MSVELEEALPVTTAEGMAKKVTKAGGSAALSPSKKRKNSKKKNQPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLNRKKLEGGGERRGAPAAATAPAPTAHKAKKAAPGAAGSRRADKKPARGQKPEQRSHKKGAGAKKDKGGKAKKTAAAGGKKVKKAAKPSVPKVPKGRK
Weitere Angaben

Bitte wählen Sie den gewünschten Artikel

Bitte tragen Sie die Chargennummer ein. Sollte Ihnen diese nicht vorliegen, tragen Sie bitte bei "VWR-Chemikalien" ein "x" ein.

Enter Certificate Details

Select Product:

Enter the Lot number:

Choose from recent batch/lot numbers:

Oder
Kostengünstigere Alternativen prüfen & vergleichen
Wir haben eine kostengünstigere Alternative für Sie gefunden. Ihre Einsparung beträgt  pro Stück.  Sie können bis zu 3 Artikel miteinander vergleichen. Wählen Sie die gewünschten Artikel aus und drücken Sie auf Artikel vergleichen. Zum Ersetzen des ursprünglichen Artkels, geben Sie eine Menge im Alternativprodukt ein und klicken Sie auf Ersetzen.

Ursprünglicher Artikel:

Beschreibung Artikelnummer Verfügbarkeit Einheit Ihr Preis Preis pro Menge