Sitzung fortführen?
Automatische Abmeldung in: 
Sitzung abgelaufen!
Ihre Sitzung ist abgelaufen. Zu Ihrer Sicherheit haben wir Sie abgemeldet.
Möchten Sie sich wieder anmelden?

Anti-SOX10 Mouse Monoclonal Antibody [clone: 1E6]

Lieferant: US Biological
Recommended dilution: Immunochemistry: 1. 5 μg/ml

Type: Primary
Antigen: SOX10 (SRY (sex determining region Y)-box 10)
Clonality: monoclonal
Clone: 1000000
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a Kappa
Reactivity: Human




 

PRODUKT

Erweitert / Kompakt
Größe VE Katalognummer Menge
100 µg 100 µG USBI133713
Barcode erstellen Barcode Label Format: 
PDF Katalogseiten erstellen

TECHNISCHE DATEN

Antigen symbol SOX10
Antigen name SRY (sex determining region Y)-box 10
Reaktivität Human
Konjugation Unconjugated
Klonalität Monoclonal
Antikörper Typ Primary
Clone 1E6
Host Mouse
Isotype IgG2a kappa
Western blot Yes
ELISA Yes
Amino acid number 336 to 434
Purification purified by Protein A chromatography
Sequence KPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQR*
Form liquid
Storage buffer PBS, pH 7,2.
Lagertemperatur Cool
Transporttemperatur Ice

BEWERTUNG VERFASSEN

Brauchen Sie Hilfe?

  • Was auch immer Sie zu sagen haben, positiv oder negativ, ist uns wichtig.
  • Das Bewerten dauert nur wenige Sekunden
  • Ihre Meinung wird öffentlich zur Verfügung gestellt.

VWR wird Ihren Namen als VWR Nutzer veröffentlichen.
Sie können diesen Namen nutzen oder vorher nochmal ändern und erneut abspeichern.
Wir empfehlen Initialien oder Spitznamen.

Bitte bestätigen Sie die Branche.

Beispiel: Pharma

Bitte bestätigen Sie Ihre Rolle.

Beispiel: Techniker

Bitte bestätigen Sie den Ort

Beispiel: Frankfurt

BEWERTUNGEN (0)

Gesamtbewertung: 0
Bewertung: 0.0 von 5

Sortieren nach:

Weitere Angaben

Bitte wählen Sie den gewünschten Artikel

Bitte tragen Sie die Chargennummer ein. Sollte Ihnen diese nicht vorliegen, tragen Sie bitte bei "VWR-Chemikalien" ein "x" ein.

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

Oder
Kostengünstigere Alternativen prüfen & vergleichen
Wir haben eine kostengünstigere Alternative für Sie gefunden. Ihre Einsparung beträgt  pro Stück.  Sie können bis zu 3 Artikel miteinander vergleichen. Wählen Sie die gewünschten Artikel aus und drücken Sie auf Artikel vergleichen. Zum Ersetzen des ursprünglichen Artkels, geben Sie eine Menge im Alternativprodukt ein und klicken Sie auf Ersetzen.

Ursprünglicher Artikel:

Beschreibung Artikelnummer Verfügbarkeit Einheit Ihr Preis Preis pro Menge